| Contents | +Transport layer | +Packet format | +Application Protocol | +
| Contents | +Transport layer | +Packet format | +Application Protocol | +
apsmanagerapsmanager.getstat<call ...>
+ <apsmanager method="getstat" model*="" />
+</call><response>
+ <apsmanager status="status" />
+</response>| Contents | +Transport layer | +Packet format | +Application Protocol | +
cardmngAs the name might imply, this service is responsible for handling interactions with physical e-Amusement cards.
+ e-Amusement currently has two different types of cards in circulation. There are classic e-Amusement cards
+ making use of a magnetic stripe, and the newer RFID cards using FeliCa (these are probably what you have). They
+ are identified in requests using the cardtype attribute as in the below table.
+
e-Amusement cards have a "card number" and a "card id". Confusingly, neither is a number. The card number is the + one printed on your card. The card ID is your KONAMI ID. The number is derrived from your ID using an algorithm + that I'll detail here once I get round to it.
+In the interest of not wasting space, cardid and cardtype will be omitted from
+ individual breakdowns where their meaning is obvious.
cardtype |
+ Meaning | +
1 |
+ Old style magnetic stripe card | +
2 |
+ FeliCa RFID card | +
cardmng.inquirecardmng.getrefidcardmng.bindmodelcardmng.bindcardcardmng.authpasscardmng.getkeepspancardmng.getkeepremaincardmng.getdatalistcardmng.inquireRequest information about a card that has been inserted or touched against a reader.
+ +<call ...>
+ <cardmng method="inquire" cardid="" cardtype="" update="" model*="" />
+</call>update |
+ Should the tracked last play time be updated by this inquiry? (Just a guess) | +
<response>
+ <cardmng status="status" refid="" dataid="" pcode="" newflag="" binded="" expired=" ecflag="" useridflag="" extidflag="" lastupdate="" />
+</response>To handle this request, we first must lookup if this cardid has ever been seen by our servers
+ before. If not, we abort with a 112 status. Otherwise, we proceeed to check if this card has been
+ seen for this specific game. If we have never seen this card used on this game, it is possible this card was
+ used with an older version of this game, and migration is supported, in which case we report as if we had found
+ a profile for this game.
refid |
+ A reference to this card to be used in other requests | +
dataid |
+ Appears to be set the same as refid; presumably to allow different keys for game state vs
+ login details. |
+
newflag |
+ Inverse of binded |
+
binded |
+ Has a profile ever been created for this game (or an older version, requiring a migration)
+ (1 or 0) |
+
expired |
+ ? Just set to 0. |
+
cardmng.getrefidRegister a new card to this server.
+<call ...>
+ <cardmng method="getrefid" cardtype="" cardid=" newflag="" passwd="" model*="" />
+</call>newflag |
+ ? | +
passwd |
+ The pin for this new user. Should always be a four digit number (and that's worth validating), + but it's passed as a string so could feasibly be anything desired. | +
<response>
+ <cardmng status="status" refid="" dataid="" pcode="" />
+</response>refid |
+ A reference to this card to be used in other requests | +
dataid |
+ Appears to be set the same as refid; presumably to allow different keys for game state vs
+ login details. |
+
pcode |
+ ? Not present in captured data. | +
cardmng.bindmodel<call ...>
+ <cardmng method="bindmodel" refid="" newflag="" model*="" />
+</call><response>
+ <cardmng status="status" dataid="" />
+</response>cardmng.bindcard<call ...>
+ <cardmng method="bindcard" cardtype="" newid="" refid="" model*="" />
+</call><response>
+ <cardmng status="status" />
+</response>cardmng.authpassTest a pin for a card. This request notably uses the refid, so required a
+ cardmng.inquire call to be made first.
+
<call ...>
+ <cardmng method="authpass" refid="" pass="" model*="" />
+</call>refid |
+ The reference we received either during cardmng.inquire or cardmng.getrefid
+ (the latter for new cards) |
+
pass |
+ The pin to test. See cardmng.getrefid. |
+
<response>
+ <cardmng status="status" />
+</response>If the pin is valid, status should be 0. Otherwise, 116.
cardmng.getkeepspan<call ...>
+ <cardmng method="getkeepspan" model*="" />
+</call><response>
+ <cardmng status="status" keepspan="" />
+</response>cardmng.getkeepremain<call ...>
+ <cardmng method="getkeepremain" refid="" model*="" />
+</call><response>
+ <cardmng status="status" keepremain="" />
+</response>cardmng.getdatalist<call ...>
+ <cardmng method="getdatalist" refid="" model*="" />
+</call><response>
+ <cardmng status="status">
+ <item[]>
+ <mcode __type="str" />
+ <dataid __type="str" />
+ <regtime __type="str" />
+ <lasttime __type="str" />
+ <exptime __type="str" />
+ <expflag __type="u8" />
+ </item[]>
+ </cardmng>
+</response>| Contents | +Transport layer | +Packet format | +Application Protocol | +
dlstatusdlstatus.done<call ...>
+ <dlstatus method="done">
+ <url>
+ <param __type="str" />
+ </url>
+ <name __type="str" />
+ <size __type="s32" />
+ </dlstatus>
+</call><response>
+ <dlstatus status="status">
+ <progress __type="s32" />
+ </dlstatus>
+</response>dlstatus.progress<call ...>
+ <dlstatus method="progress" />
+ <progress __type="s32" />
+ </dlstatus>
+</call><response>
+ <dlstatus status="status" />
+</response>| Contents | +Transport layer | +Packet format | +Application Protocol | +
eacoineacoin.checkin<call ...>
+ <eacoin method="checkin">
+ <cardtype __type="str" />
+ <cardid __type="str" />
+ <passwd __type="str" />
+ <ectype __type="str" />
+ </eacoin>
+</call><response>
+ <eacoin status="status">
+ <sequence __type="s16" />
+ <acstatus __type="u8" />
+ <acid __type="str" />
+ <acname __type="str" />
+ <balance __type="s32" />
+ <sessid __type="str" />
+ </eacoin>
+</response>eacoin.checkout<call ...>
+ <eacoin method="checkout">
+ <sessid __type="str" />
+ </eacoin>
+</call><response>
+ <eacoin status="status" />
+</response>eacoin.consume<call ...>
+ <eacoin method="consume" esid="">
+ <sessid __type="str" />
+ <sequence __type="s16" />
+ <payment __type="s32" />
+ <service __type="s16" />
+ <itemtype __type="str" />
+ <detail __type="str" />
+ </eacoin>
+</call><response>
+ <eacoin status="status">
+ <acstatus __type="u8" />
+ <autocharge __type="u8" />
+ <balance __type="s32" />
+ </eacoin>
+</response>eacoin.getbalance<call ...>
+ <eacoin method="getbalance">
+ <sessid __type="str" />
+ </eacoin>
+</call><response>
+ <eacoin status="status">
+ <acstatus __type="u8" />
+ <balance __type="s32" />
+ </eacoin>
+</response>eacoin.getecstatus<call ...>
+ <eacoin method="getecstatus" />
+</call><response>
+ <eacoin status="status">
+ <ectype __type="str" />
+ <ecstatus __type="u8" />
+ </eacoin>
+</response>eacoin.touch<call ...>
+ <eacoin method="touch">
+ <sessid __type="str" />
+ </eacoin>
+</call><response>
+ <eacoin status="status" />
+</response>eacoin.opchpass<call ...>
+ <eacoin method="opchpass">
+ <passwd __type="str" />
+ <newpasswd __type="str" />
+ </eacoin>
+</call><response>
+ <eacoin status="status" />
+</response>eacoin.opcheckin<call ...>
+ <eacoin method="opcheckin">
+ <passwd __type="str" />
+ </eacoin>
+</call><response>
+ <eacoin status="status">
+ <sessid __type="str" />
+ </eacoin>
+</response>eacoin.opcheckout<call ...>
+ <eacoin method="opcheckout">
+ <sessid __type="str" />
+ </eacoin>
+</call><response>
+ <eacoin status="status" />
+</response>eacoin.getlog<call ...>
+ <eacoin method="getlog">
+ <sessid __type="str" />
+ <logtype __type="str" />
+ <ectype __type="str" />
+ <target __type="str" />
+ <perpage __type="s16" />
+ <page __type="s16" />
+ <sesstype __type="str" />
+ </eacoin>
+</call><response>
+ <eacoin status="status">
+ <processing __type="u8" />
+ <topic>
+ <sumdate __type="str" />
+ <sumfrom __type="str" />
+ <sumto __type="str" />
+
+ <today __type="s32" />
+ <average __type="s32" />
+ <total __type="s32" />
+ </topic>
+ <summary>
+ <items __type="s32" />
+ </summary>
+ <history>
+ <item[]>
+ <date __type="str" />
+ <consume __type="s32" />
+ <service __type="s32" />
+ <cardtype __type="str" />
+ <cardno __type="str" />
+ <title __type="str" />
+ <systemid __type="str" />
+ </item[]>
+ </history>
+ </eacoin>
+</response>| Contents | +Transport layer | +Packet format | +Application Protocol | +
esignesign.request<call ...>
+ <esign method="request">
+ placeholder
+ </esign>
+</call><response>
+ <esign status="status">
+ placeholder
+ </esign>
+</response>| Contents | +Transport layer | +Packet format | +Application Protocol | +
esocesoc.read<call ...>
+ <esoc method="read">
+ <senddata />
+ </esoc>
+</call><response>
+ <esoc status="status">
+ <recvdata />
+ </esoc>
+</response>Go figure.
+ +esoc.write<call ...>
+ <esoc method="write">
+ <senddata />
+ </esoc>
+</call><response>
+ <esoc status="status" />
+</response>| Contents | +Transport layer | +Packet format | +Application Protocol | +
eventlogeventlog.write<call ...>
+ <eventlog method="write">
+ <retrycnt __type="u32" />
+ <data>
+ <eventid __type="str" />
+ <eventorder __type="s32" />
+ <pcbtime __type="u64" />
+ <gamesession __type="s64" />
+ <strdata1 __type="str" />
+ <strdata2 __type="str" />
+ <numdata1 __type="s64" />
+ <numdata2 __type="s64" />
+ <locationid __type="str" />
+ </data>
+ </eventlog>
+</call>Event ID list:
+G_GAMEDS_ERRORS_PWRON TODO: find more!T_OTDEMO<response>
+ <eventlog status="status">
+ <gamesession __type="s64" />
+ <logsendflg __type="s32" />
+ <logerrlevel __type="s32" />
+ <evtidnosendflg __type="s32" />
+ </eventlog>
+</response>| Contents | +Transport layer | +Packet format | +Application Protocol | +
facilityfacility.get<call ...>
+ <facility method="get" privateip*="" encoding*="" />
+</call><response>
+ <facility expire=""\ status="status">
+ <calendar*>
+ <year __type="s16" />
+ <holiday __type="s16" />
+ </calendar>
+ <location>
+ <id __type="str" />
+ <country __type="str" />
+ <region __type="str" />
+ <name __type="str" />
+ <type __type="u8" />
+ <countryname __type="str" />
+ <countryjname __type="str" />
+ <regionname __type="str" />
+ <regionjname __type="str" />
+ <customercode __type="str" />
+ <companycode __type="str" />
+ <latitude __type="s32" />
+ <longitude __type="s32" />
+ <accuracy __type="u8" />
+ </location>
+ <line>
+ <id __type="str" />
+ <class __type="u8" />
+ </line>
+ <portfw>
+ <globalip __type="ip4" />
+ <globalport __type="s16" />
+ <privateport __type="s16" />
+ </portfw>
+ <public>
+ <flag __type="u8" />1</ flag>
+ <name __type="str" />
+ <latitude __type="str">0<latitude>
+ <longitude __type="str">0<longitude>
+ </public>
+ <share>
+ <eapass*>
+ <valid __type="?" />
+ </eapass>
+ <eacoin>
+ <notchamount __type="s32" />
+ <notchcount __type="s32" />
+ <supplylimit __type="s32">100000<supplylimit>
+ </eacoin>
+ <url>
+ <eapass __type="str">www.ea-pass.konami.net<eapass>
+ <arcadefan __type="str">www.konami.jp/am<arcadefan>
+ <konaminetdx __type="str">http://am.573.jp<konaminetdx>
+ <konamiid __type="str">http://id.konami.jp<konamiid>
+ <eagate __type="str">http://eagate.573.jp<eagate>
+ </url>
+ </share>
+ </facility>
+</response>I'm not totally sure what type share/eapass/valid is meant to be, but it's optional, so I'd
+ suggest just not bothering and leaving it out :).
| Country | +Code | +
| Hong Kong | +HK |
+
| Taiwan | +TW |
+
| Korea | +KR |
+
| USA | +US |
+
| Thailand | +TH |
+
| Indonesia | +ID |
+
| Singapore | +SG |
+
| Phillipines | +PH |
+
| Macao | +MO |
+
| Japan | +JP |
+
globalip (and associated ports) shold be the IP:port of the cabinet.
region is used for Japan, and has the value JP-[prefecture] where prefecture ranges
+ from 1 through 47.
TODO: Compile the list of regions
+ \ No newline at end of file diff --git a/proto/game/sv4.html b/proto/game/sv4.html new file mode 100644 index 0000000..afd231d --- /dev/null +++ b/proto/game/sv4.html @@ -0,0 +1,387 @@ + + + + + + + +| Contents | +Transport layer | +Packet format | +Application Protocol | +
gamegame.sv4_sample<call ...>
+ <game method="sv4_sample">
+ placeholder
+ </game>
+</call><response>
+ <game status="status">
+ placeholder
+ </game>
+</response>game.sv4_new<call ...>
+ <game method="sv4_new">
+ placeholder
+ </game>
+</call><response>
+ <game status="status">
+ placeholder
+ </game>
+</response>game.sv4_load<call ...>
+ <game method="sv4_load">
+ placeholder
+ </game>
+</call><response>
+ <game status="status">
+ placeholder
+ </game>
+</response>game.sv4_load_m<call ...>
+ <game method="sv4_load_m">
+ placeholder
+ </game>
+</call><response>
+ <game status="status">
+ placeholder
+ </game>
+</response>game.sv4_save<call ...>
+ <game method="sv4_save">
+ placeholder
+ </game>
+</call><response>
+ <game status="status">
+ placeholder
+ </game>
+</response>game.sv4_save_m<call ...>
+ <game method="sv4_save_m">
+ placeholder
+ </game>
+</call><response>
+ <game status="status">
+ placeholder
+ </game>
+</response>game.sv4_common<call ...>
+ <game method="sv4_common">
+ placeholder
+ </game>
+</call><response>
+ <game status="status">
+ placeholder
+ </game>
+</response>game.sv4_shop<call ...>
+ <game method="sv4_shop">
+ placeholder
+ </game>
+</call><response>
+ <game status="status">
+ placeholder
+ </game>
+</response>game.sv4_hiscore<call ...>
+ <game method="sv4_hiscore">
+ placeholder
+ </game>
+</call><response>
+ <game status="status">
+ placeholder
+ </game>
+</response>game.sv4_buy<call ...>
+ <game method="sv4_buy">
+ placeholder
+ </game>
+</call><response>
+ <game status="status">
+ placeholder
+ </game>
+</response>game.sv4_exception<call ...>
+ <game method="sv4_exception">
+ placeholder
+ </game>
+</call><response>
+ <game status="status">
+ placeholder
+ </game>
+</response>game.sv4_entry_s<call ...>
+ <game method="sv4_entry_s">
+ placeholder
+ </game>
+</call><response>
+ <game status="status">
+ placeholder
+ </game>
+</response>game.sv4_entry_e<call ...>
+ <game method="sv4_entry_e">
+ placeholder
+ </game>
+</call><response>
+ <game status="status">
+ placeholder
+ </game>
+</response>game.sv4_frozen<call ...>
+ <game method="sv4_frozen">
+ placeholder
+ </game>
+</call><response>
+ <game status="status">
+ placeholder
+ </game>
+</response>game.sv4_lounce<call ...>
+ <game method="sv4_lounce">
+ placeholder
+ </game>
+</call><response>
+ <game status="status">
+ placeholder
+ </game>
+</response>game.sv4_save_e<call ...>
+ <game method="sv4_save_e">
+ placeholder
+ </game>
+</call><response>
+ <game status="status">
+ placeholder
+ </game>
+</response>game.sv4_save_pb<call ...>
+ <game method="sv4_save_pb">
+ placeholder
+ </game>
+</call><response>
+ <game status="status">
+ placeholder
+ </game>
+</response>game.sv4_save_c<call ...>
+ <game method="sv4_save_c">
+ placeholder
+ </game>
+</call><response>
+ <game status="status">
+ placeholder
+ </game>
+</response>game.sv4_play_s<call ...>
+ <game method="sv4_play_s">
+ placeholder
+ </game>
+</call><response>
+ <game status="status">
+ placeholder
+ </game>
+</response>game.sv4_play_e<call ...>
+ <game method="sv4_play_e">
+ placeholder
+ </game>
+</call><response>
+ <game status="status">
+ placeholder
+ </game>
+</response>game.sv4_serial<call ...>
+ <game method="sv4_serial">
+ placeholder
+ </game>
+</call><response>
+ <game status="status">
+ placeholder
+ </game>
+</response>game.sv4_save_fi<call ...>
+ <game method="sv4_save_fi">
+ placeholder
+ </game>
+</call><response>
+ <game status="status">
+ placeholder
+ </game>
+</response>game.sv4_print<call ...>
+ <game method="sv4_print">
+ placeholder
+ </game>
+</call><response>
+ <game status="status">
+ placeholder
+ </game>
+</response>game.sv4_print_h<call ...>
+ <game method="sv4_print_h">
+ placeholder
+ </game>
+</call><response>
+ <game status="status">
+ placeholder
+ </game>
+</response>game.sv4_load_r<call ...>
+ <game method="sv4_load_r">
+ placeholder
+ </game>
+</call><response>
+ <game status="status">
+ placeholder
+ </game>
+</response>game.sv4_save_campaign<call ...>
+ <game method="sv4_save_campaign">
+ placeholder
+ </game>
+</call><response>
+ <game status="status">
+ placeholder
+ </game>
+</response>| Contents | +Transport layer | +Packet format | +Application Protocol | +
matchingmatching.request<call ...>
+ <matching method="request">
+ <info>
+ <version __type="s32" />
+ </info>
+ <data>
+ <matchtyp __type="s32" />
+ <matchgrp __type="s32" />
+ <matchflg __type="s32" />
+ <waituser __type="s32" />
+ <waittime __type="s32" />
+ <joinip __type="str" />
+ <localip __type="str" />
+ <localport __type="s32" />
+ <dataid __type="str" />
+ <gamekind __type="str" />
+ <locationid __type="str" />
+ <lineid __type="str" />
+ <locationcountry __type="str" />
+ <locationregion __type="str" />
+ </data>
+ </matching>
+</call><response>
+ <matching status="status">
+ <hostid __type="s64" />
+ <result __type="s32" />
+ <hostip_g __type="str" />
+ <hostip_l __type="str" />
+ <hostport_l __type="s32" />
+ <hostport_g __type="s32" />
+ </matching>
+</response>matching.wait<call ...>
+ <matching method="wait">
+ <info>
+ <version __type="s32" />
+ </info>
+ <data>
+ <hostid __type="s64" />
+ <locationid __type="str" />
+ <lineid __type="str" />
+ </data>
+ </matching>
+</call><response>
+ <matching status="status">
+ <result __type="s32" />
+ <prwtime __type="s32" />
+ </matching>
+</response>matching.finish<call ...>
+ <matching method="finish">
+ <info>
+ <version __type="s32" />
+ </info>
+ <data>
+ <hostid __type="s64" />
+ <locationid __type="str" />
+ <lineid __type="str" />
+ </data>
+ </matching>
+</call><response>
+ <matching status="status">
+ <result __type="s32" />
+ </matching>
+</response>| Contents | +Transport layer | +Packet format | +Application Protocol | +
messagemessage.get<call ...>
+ <message method="get" model*="" />
+</call><response>
+ <message expire="" status="status">
+ <item[] name="" start="" end="" data="" />
+ </message>
+</response>| Contents | +Transport layer | +Packet format | +Application Protocol | +
packagepackage.list<call ...>
+ <package method="list" pkgtype="pkgtype" model*="" />
+</call>all is the only currently observed value for pkgtype
<response>
+ <package status="status">
+ <item[] url="" />
+ </package>
+</response>A list of all packages available for download.
+ +package.intend<call ...>
+ <package method="intend" url="" model*="" />
+</call><response>
+ <package status="status" />
+</response>| Contents | +Transport layer | +Packet format | +Application Protocol | +
pcbeventpcbevent.put<call ...>
+ <pcbevent method="put">
+ <time __type="time" />
+ <seq __type="u32" />
+ <item[]>
+ <name __type="str" />
+ <value __type="s32" />
+ <time __type="time" />
+ </item[]>
+ </pcbevent>
+</call><response>
+ <pcbevent status="status" />
+</response>| Contents | +Transport layer | +Packet format | +Application Protocol | +
pcbtrackerpcbtracker.alive<call ...>
+ <pcbtracker method="alive" model*="" hardid="" softid="" accountid="" agree="" ecflag="" />
+</call>ecflag here is determining if the arcade operator allows the use of paseli on this machine.
agree@ and ecflag@ appear to either be totally non present, or present with a value of
+ "1", but then again I may be reading the code wrong, so take that with a pinch of salt.
+
<response>
+ <pcbtracker status="" time="" limit="" ecenable="" eclimit="" >
+</response>As you might guess, ecenable@ is therefore the flag to determine if paseli is enabled (i.e. the
+ arcade operator and the server both allow its use).
| Contents | +Transport layer | +Packet format | +Application Protocol | +
playerdataplayerdata.usergamedata_send<call ...>
+ <playerdata method="usergamedata_send">
+ <retrycnt __type="u32" />
+ <info>
+ <version __type="u32" />
+ </info>
+ <data>
+ <refid __type="str" />
+ <dataid __type="str" />
+ <gamekind __type="str" />
+ <datanum __type="u32" />
+ <record>
+ <d[] __type="str" />
+ </record>
+ </data>
+ </playerdata>
+</call><response>
+ <playerdata status="status">
+ <result __type="s32" />
+ </playerdata>
+</response>playerdata.usergamedata_recv<call ...>
+ <playerdata method="usergamedata_recv">
+ <info>
+ <version __type="u32" />
+ </info>
+ <data>
+ <refid __type="str">
+ <dataid __type="str">
+ <gamekind __type="str">
+ <recv_num __type="u32">
+ </data>
+ </playerdata>
+</call><call ...>
+ <playerdata method="usergamedata_recv">
+ <data>
+ <refid __type="str">
+ <dataid __type="str">
+ <gamekind __type="str">
+ <recv_csv __type="str">
+ </data>
+ </playerdata>
+</call><response>
+ <playerdata status="status">
+ <player>
+ <result>
+ <record_num __type="u32" />
+ </result>
+ <record>
+ <d[]>
+ <bin1 __type="str" />
+ </d[]>
+ </record>
+ </player>
+ </playerdata>
+</response>playerdata.usergamedata_inheritanceSee: playerdata.usergamedata_recv
playerdata.usergamedata_condrecv<call ...>
+ <playerdata method="usergamedata_condrecv">
+ <info>
+ <version __type="s32" />
+ </info>
+ <data>
+ <dataid __type="str" />
+ <gamekind __type="str" />
+ <vkey __type="str" />
+ <conditionkey __type="str" />
+ <columns_bit __type="u64" />
+ <conditions_num __type="u32" />
+ <where __type="str" />
+ <order_num __type="u32" />
+ <order __type="str" />
+ <recv_num __type="u32" />
+ </info>
+ </playerdata>
+</call><response>
+ <playerdata status="status">
+ <player>
+ <result __type="s32" />
+ <record_num __type="s32" />
+ <record>
+ <d[]>
+ <bin1 __type="str" />
+ </d[]>
+ <record/>
+ </player>
+ </playerdata>
+</response>playerdata.usergamedata_scorerank<call ...>
+ <playerdata method="usergamedata_scorerank">
+ <info>
+ <version __type="s32" />
+ </info>
+ <data>
+ <dataid __type="str" />
+ <gamekind __type="str" />
+ <ckey __type="str" />
+ <conditionkey __type="str" />
+ <score __type="str" />
+ </data>
+ </playerdata>
+</call><response>
+ <playerdata status="status">
+ <rank>
+ <result __type="s32" />
+ <rank __type="s32" />
+ <updatetime __type="u64" />
+ </rank>
+ </playerdata>
+</response>| Contents | +Transport layer | +Packet format | +Application Protocol | +
servicesservices.get<call ...>
+ <services method="get" model*="" >
+ <info>
+ <AVS2 __type="str">AVS2 version</AVS2>
+ </info>
+ </services>
+</call><response>
+ <services expire="" method="get" mode="" status="status">
+ <item[] name="service" url="url" />
+ </services>
+</response>Known services are:
+ntpkeepalivecardmngfacilitymessagenumberingpackagepcbeventpcbtrackerpkglistposeventuserdatauserideacoinlocallocal2lobbylobby2dlstatusnetlogsidmgrglobbyMost of these will usually just return the URL to the eAmuse server (or your fake one ;D). ntp is a
+ notable exception, unless you're planning on reimplementing NTP. keepalive will likely alsop be a
+ custom URL with query parameters pre-baked.
mode is one of operation, debug, test, or
+ factory.
+
| Contents | +Transport layer | +Packet format | +Application Protocol | +
sidmgrsidmgr.create<call ...>
+ <sidmgr method="create">
+ <cardtype __type="str" />
+ <cardid __type="str" />
+ <cardgid __type="str" />
+ <steal __type="u8" />
+ </sidmgr>
+</call><response>
+ <sidmgr status="status">
+ <state __type="u32" />
+ <e_count __type="u8" />
+ <last __type="time" />
+ <locked __type="time" />
+ <sid __type="str" />
+ <cardid_status __type="u8" />
+ <refid __type="str" />
+ </sidmgr>
+</response>sidmgr.open<call ...>
+ <sidmgr method="open" sid="" >
+ <pass __type="str" />
+ </sidmgr>
+</call><response>
+ <sidmgr status="status">
+ <state __type="u32" />
+ <refid __type="str" />
+ <locked __type="time" />
+ </sidmgr>
+</response>sidmgr.touch<call ...>
+ <sidmgr method="touch" sid="" />
+</call><response>
+ <sidmgr status="status" />
+</response>sidmgr.branch<call ...>
+ <sidmgr method="branch" sid="" />
+</call><response>
+ <sidmgr status="status" />
+</response>sidmgr.close<call ...>
+ <sidmgr method="close" sid="" />
+ <cause __type="u32" />
+ </sidmgr>
+</call><response>
+ <sidmgr status="status" />
+</response>| Contents | +Transport layer | +Packet format | +Application Protocol | +
systemsystem.getmaster<call ...>
+ <system method="getmaster">
+ <data>
+ <gamekind __type="str" />
+ <datatype __type="str" />
+ <datakey __type="str" />
+ </data>
+ </system>
+</call><response>
+ <system status="status">
+ <result __type="s32" />
+ <strdata1 __type="str" />
+ <strdata2 __type="str" />
+ <updatedate __type="u64" />
+ </system>
+</response>system.getlocationiplist<call ...>
+ <system method="getlocationiplist">
+ <data>
+ <locationid __type="str" />
+ <lineid __type="str" />
+ </data>
+ </system>
+</call><response>
+ <system status="status">
+ <result __type="s32" />
+ <iplist>
+ <record_num __type="s32" />
+ <record[]>
+ <localconn __type="str" />
+ </record[]>
+ </iplist>
+ </system>
+</response>system.xrpcproxy<call ...>
+ <system method="xrpcproxy">
+ <info>
+ <version __type="s32" />
+ </info>
+ <data>
+ <hostid __type="s64" />
+ <locationid __type="str" />
+ <lineid __type="str" />
+ </data>
+ </system>
+</call><response>
+ <system status="status">
+ <result __type="s32" />
+ <pwrtime __type="s32" />
+ <matchlist>
+ <record_num __type="u32" />
+ <record[]>
+ <pcbid __type="str" />
+ <statusflg __type="str" />
+ <matchgrp __type="s32" />
+ <hostid __type="s64" />
+ <jointime __type="u64" />
+ <connip_g __type="str" />
+ <connport_g __type="s32" />
+ <connip_l __type="str" />
+ <connport_l __type="s32" />
+ </record[]>
+ </matchlist>
+ </system>
+</response>system.convcardnumber<call ...>
+ <system method="convcardnumber">
+ <info>
+ <version __type="s32" />
+ </info>
+ <data>
+ <card_id __type="str" />
+ <card_type __type="s32" />
+ </data>
+ </system>
+</call><response>
+ <system status="status">
+ <result __type="s32" />
+ <data>
+ <card_number __type="str" />
+ </data>
+ </system>
+</response>| Contents | +Transport layer | +Packet format | +Application Protocol | +
traceroutetraceroute.send<call ...>
+ <traceroute proto="" method="send">
+ <hop[]>
+ <valid __type="bool">
+ <addr __type="ip4">
+ <usec __type="u64">
+ </hop[]>
+ </traceroute>
+</call>hop repeats for every hop (unsurprisingly)
<response>
+ <traceroute status="status" />
+</response>| Contents | +Transport layer | +Packet format | +Application Protocol | +
userdatauserdata.read<call ...>
+ <userdata method="read" card*="" model*="" label="" />
+</call><response>
+ <userdata status="status" time="">
+ <b[] __type="" />
+ </userdata>
+</response>__type here can be either bin or str
userdata.write<call ...>
+ <userdata method="write" card="" time="" model*="" label*="" >
+ <b[] __type="str" />
+ </userdata>
+</call><response>
+ <userdata status="status" />
+</response>eventlog.%seventlog.%splayerdata.%splayerdata.%splayerdata.usergamedata_sendplayerdata.usergamedata_recvplayerdata.usergamedata_inheritanceplayerdata.usergamedata_condrecvplayerdata.usergamedata_scorerankplayerdata.usergamedata_sendplayerdata.usergamedata_recvplayerdata.usergamedata_inheritance
+ playerdata.usergamedata_condrecv
+ playerdata.usergamedata_scorerank
+ matching.%smatching.%smatching.requestmatching.waitmatching.finishmatching.requestmatching.waitmatching.finishsystem.%ssystem.%ssystem.getmastersystem.getlocationiplistsystem.xrpcproxysystem.convcardnumbersystem.getmastersystem.getlocationiplistsystem.xrpcproxysystem.convcardnumberesoc.%sesoc.%sesoc.readesoc.writeesoc.readesoc.writecardmng.%scardmng.%scardmng.inquirecardmng.getrefidcardmng.bindmodelcardmng.bindcardcardmng.authpasscardmng.getkeepspancardmng.getkeepremaincardmng.getdatalistcardmng.inquirecardmng.getrefidcardmng.bindmodelcardmng.bindcardcardmng.authpasscardmng.getkeepspancardmng.getkeepremaincardmng.getdatalistesign.%sesign.%spackage.%spackage.%suserdata.%suserdata.%sservices.%sservices.%spcbtracker.%spcbtracker.%spcbevent.%spcbevent.%smessage.%smessage.%sfacility.%sfacility.%sapsmanager.%sapsmanager.%ssidmgr.%ssidmgr.%ssidmgr.createsidmgr.opensidmgr.touchsidmgr.branchsidmgr.closesidmgr.createsidmgr.opensidmgr.touchsidmgr.branchsidmgr.closedlstatus.%sdlstatus.%seacoin.%seacoin.%seacoin.checkineacoin.checkouteacoin.consumeeacoin.getbalanceeacoin.getecstatuseacoin.toucheacoin.opchpasseacoin.opcheckineacoin.opcheckouteacoin.getlogeacoin.checkineacoin.checkouteacoin.consumeeacoin.getbalanceeacoin.getecstatuseacoin.toucheacoin.opchpasseacoin.opcheckineacoin.opcheckouteacoin.getlogtraceroute.%straceroute.%sgame.%sgame.%sgame.sv4_samplegame.sv4_newgame.sv4_loadgame.sv4_load_mgame.sv4_savegame.sv4_save_mgame.sv4_commongame.sv4_shopgame.sv4_hiscoregame.sv4_buygame.sv4_exceptiongame.sv4_entry_sgame.sv4_entry_egame.sv4_frozengame.sv4_louncegame.sv4_save_egame.sv4_save_pbgame.sv4_save_cgame.sv4_play_sgame.sv4_play_egame.sv4_serialgame.sv4_save_figame.sv4_printgame.sv4_print_hgame.sv4_load_rgame.sv4_save_campaigngame.sv4_samplegame.sv4_newgame.sv4_loadgame.sv4_load_mgame.sv4_savegame.sv4_save_mgame.sv4_commongame.sv4_shopgame.sv4_hiscoregame.sv4_buygame.sv4_exceptiongame.sv4_entry_sgame.sv4_entry_egame.sv4_frozengame.sv4_louncegame.sv4_save_egame.sv4_save_pbgame.sv4_save_cgame.sv4_play_sgame.sv4_play_egame.sv4_serialgame.sv4_save_figame.sv4_printgame.sv4_print_hgame.sv4_load_rgame.sv4_save_campaigneventlogeventlog.write<call ...>
- <eventlog method="write">
- <retrycnt __type="u32" />
- <data>
- <eventid __type="str" />
- <eventorder __type="s32" />
- <pcbtime __type="u64" />
- <gamesession __type="s64" />
- <strdata1 __type="str" />
- <strdata2 __type="str" />
- <numdata1 __type="s64" />
- <numdata2 __type="s64" />
- <locationid __type="str" />
- </data>
- </eventlog>
-</call>Event ID list:
+ + Totally undocumented services (based onservices.get):
G_GAMEDS_ERRORS_PWRON TODO: find more!T_OTDEMO<response>
- <eventlog status="status">
- <gamesession __type="s64" />
- <logsendflg __type="s32" />
- <logerrlevel __type="s32" />
- <evtidnosendflg __type="s32" />
- </eventlog>
-</response>playerdataplayerdata.usergamedata_send<call ...>
- <playerdata method="usergamedata_send">
- <retrycnt __type="u32" />
- <info>
- <version __type="u32" />
- </info>
- <data>
- <refid __type="str" />
- <dataid __type="str" />
- <gamekind __type="str" />
- <datanum __type="u32" />
- <record>
- <d[] __type="str" />
- </record>
- </data>
- </playerdata>
-</call><response>
- <playerdata status="status">
- <result __type="s32" />
- </playerdata>
-</response>playerdata.usergamedata_recv<call ...>
- <playerdata method="usergamedata_recv">
- <info>
- <version __type="u32" />
- </info>
- <data>
- <refid __type="str">
- <dataid __type="str">
- <gamekind __type="str">
- <recv_num __type="u32">
- </data>
- </playerdata>
-</call><call ...>
- <playerdata method="usergamedata_recv">
- <data>
- <refid __type="str">
- <dataid __type="str">
- <gamekind __type="str">
- <recv_csv __type="str">
- </data>
- </playerdata>
-</call><response>
- <playerdata status="status">
- <player>
- <result>
- <record_num __type="u32" />
- </result>
- <record>
- <d[]>
- <bin1 __type="str" />
- </d[]>
- </record>
- </player>
- </playerdata>
-</response>playerdata.usergamedata_inheritanceSee: playerdata.usergamedata_recv
playerdata.usergamedata_condrecv<call ...>
- <playerdata method="usergamedata_condrecv">
- <info>
- <version __type="s32" />
- </info>
- <data>
- <dataid __type="str" />
- <gamekind __type="str" />
- <vkey __type="str" />
- <conditionkey __type="str" />
- <columns_bit __type="u64" />
- <conditions_num __type="u32" />
- <where __type="str" />
- <order_num __type="u32" />
- <order __type="str" />
- <recv_num __type="u32" />
- </info>
- </playerdata>
-</call><response>
- <playerdata status="status">
- <player>
- <result __type="s32" />
- <record_num __type="s32" />
- <record>
- <d[]>
- <bin1 __type="str" />
- </d[]>
- <record/>
- </player>
- </playerdata>
-</response>playerdata.usergamedata_scorerank<call ...>
- <playerdata method="usergamedata_scorerank">
- <info>
- <version __type="s32" />
- </info>
- <data>
- <dataid __type="str" />
- <gamekind __type="str" />
- <ckey __type="str" />
- <conditionkey __type="str" />
- <score __type="str" />
- </data>
- </playerdata>
-</call><response>
- <playerdata status="status">
- <rank>
- <result __type="s32" />
- <rank __type="s32" />
- <updatetime __type="u64" />
- </rank>
- </playerdata>
-</response>matchingmatching.request<call ...>
- <matching method="request">
- <info>
- <version __type="s32" />
- </info>
- <data>
- <matchtyp __type="s32" />
- <matchgrp __type="s32" />
- <matchflg __type="s32" />
- <waituser __type="s32" />
- <waittime __type="s32" />
- <joinip __type="str" />
- <localip __type="str" />
- <localport __type="s32" />
- <dataid __type="str" />
- <gamekind __type="str" />
- <locationid __type="str" />
- <lineid __type="str" />
- <locationcountry __type="str" />
- <locationregion __type="str" />
- </data>
- </matching>
-</call><response>
- <matching status="status">
- <hostid __type="s64" />
- <result __type="s32" />
- <hostip_g __type="str" />
- <hostip_l __type="str" />
- <hostport_l __type="s32" />
- <hostport_g __type="s32" />
- </matching>
-</response>matching.wait<call ...>
- <matching method="wait">
- <info>
- <version __type="s32" />
- </info>
- <data>
- <hostid __type="s64" />
- <locationid __type="str" />
- <lineid __type="str" />
- </data>
- </matching>
-</call><response>
- <matching status="status">
- <result __type="s32" />
- <prwtime __type="s32" />
- </matching>
-</response>matching.finish<call ...>
- <matching method="finish">
- <info>
- <version __type="s32" />
- </info>
- <data>
- <hostid __type="s64" />
- <locationid __type="str" />
- <lineid __type="str" />
- </data>
- </matching>
-</call><response>
- <matching status="status">
- <result __type="s32" />
- </matching>
-</response>systemsystem.getmaster<call ...>
- <system method="getmaster">
- <data>
- <gamekind __type="str" />
- <datatype __type="str" />
- <datakey __type="str" />
- </data>
- </system>
-</call><response>
- <system status="status">
- <result __type="s32" />
- <strdata1 __type="str" />
- <strdata2 __type="str" />
- <updatedate __type="u64" />
- </system>
-</response>system.getlocationiplist<call ...>
- <system method="getlocationiplist">
- <data>
- <locationid __type="str" />
- <lineid __type="str" />
- </data>
- </system>
-</call><response>
- <system status="status">
- <result __type="s32" />
- <iplist>
- <record_num __type="s32" />
- <record[]>
- <localconn __type="str" />
- </record[]>
- </iplist>
- </system>
-</response>system.xrpcproxy<call ...>
- <system method="xrpcproxy">
- <info>
- <version __type="s32" />
- </info>
- <data>
- <hostid __type="s64" />
- <locationid __type="str" />
- <lineid __type="str" />
- </data>
- </system>
-</call><response>
- <system status="status">
- <result __type="s32" />
- <pwrtime __type="s32" />
- <matchlist>
- <record_num __type="u32" />
- <record[]>
- <pcbid __type="str" />
- <statusflg __type="str" />
- <matchgrp __type="s32" />
- <hostid __type="s64" />
- <jointime __type="u64" />
- <connip_g __type="str" />
- <connport_g __type="s32" />
- <connip_l __type="str" />
- <connport_l __type="s32" />
- </record[]>
- </matchlist>
- </system>
-</response>system.convcardnumber<call ...>
- <system method="convcardnumber">
- <info>
- <version __type="s32" />
- </info>
- <data>
- <card_id __type="str" />
- <card_type __type="s32" />
- </data>
- </system>
-</call><response>
- <system status="status">
- <result __type="s32" />
- <data>
- <card_number __type="str" />
- </data>
- </system>
-</response>esocesoc.read<call ...>
- <esoc method="read">
- <senddata />
- </esoc>
-</call><response>
- <esoc status="status">
- <recvdata />
- </esoc>
-</response>Go figure.
- -esoc.write<call ...>
- <esoc method="write">
- <senddata />
- </esoc>
-</call><response>
- <esoc status="status" />
-</response>cardmngcardmng.inquire<call ...>
- <cardmng method="inquire" cardid="" cardtype="" update="" model*="" />
-</call><response>
- <cardmng status="status" refid="" dataid="" pcode="" newflag="" binded="" expired=" ecflag="" useridflag="" extidflag="" lastupdate="" />
-</response>If the cardid cannot be found, status should be set to 112 with no other
- information return. Otherwise, we return information about the found card.
refid |
- A reference to this card to be used in other requests | -
dataid |
- Appears to be set the same as refid; presumably to allow different keys for game state vs
- login details. |
-
newflag |
- 1 or 0 |
-
binded |
- Has a profile ever been created for this game (or an older version, requiring a migration)
- (1 or 0) |
-
expired |
- Did we find | -
cardmng.getrefid<call ...>
- <cardmng method="getrefid" cardtype="" cardid=" newflag="" passwd="" model*="" />
-</call><response>
- <cardmng status="status" refid="" dataid="" pcode="" />
-</response>cardmng.bindmodel<call ...>
- <cardmng method="bindmodel" refid="" newflag="" model*="" />
-</call><response>
- <cardmng status="status" dataid="" />
-</response>cardmng.bindcard<call ...>
- <cardmng method="bindcard" cardtype="" newid="" refid="" model*="" />
-</call><response>
- <cardmng status="status" />
-</response>cardmng.authpass<call ...>
- <cardmng method="authpass" refid="" pass="" model*="" />
-</call><response>
- <cardmng status="status" />
-</response>cardmng.getkeepspan<call ...>
- <cardmng method="getkeepspan" model*="" />
-</call><response>
- <cardmng status="status" keepspan="" />
-</response>cardmng.getkeepremain<call ...>
- <cardmng method="getkeepremain" refid="" model*="" />
-</call><response>
- <cardmng status="status" keepremain="" />
-</response>cardmng.getdatalist<call ...>
- <cardmng method="getdatalist" refid="" model*="" />
-</call><response>
- <cardmng status="status">
- <item[]>
- <mcode __type="str" />
- <dataid __type="str" />
- <regtime __type="str" />
- <lasttime __type="str" />
- <exptime __type="str" />
- <expflag __type="u8" />
- </item[]>
- </cardmng>
-</response>esignesign.request<call ...>
- <esign method="request">
- placeholder
- </esign>
-</call><response>
- <esign status="status">
- placeholder
- </esign>
-</response>packagepackage.list<call ...>
- <package method="list" pkgtype="pkgtype" model*="" />
-</call>all is the only currently observed value for pkgtype
<response>
- <package status="status">
- <item[] url="" />
- </package>
-</response>A list of all packages available for download.
- -package.intend<call ...>
- <package method="intend" url="" model*="" />
-</call><response>
- <package status="status" />
-</response>userdatauserdata.read<call ...>
- <userdata method="read" card*="" model*="" label="" />
-</call><response>
- <userdata status="status" time="">
- <b[] __type="" />
- </userdata>
-</response>__type here can be either bin or str
userdata.write<call ...>
- <userdata method="write" card="" time="" model*="" label*="" >
- <b[] __type="str" />
- </userdata>
-</call><response>
- <userdata status="status" />
-</response>servicesservices.get<call ...>
- <services method="get" model*="" >
- <info>
- <AVS2 __type="str">AVS2 version</AVS2>
- </info>
- </services>
-</call><response>
- <services expire="" method="get" mode="" status="status">
- <item[] name="service" url="url" />
- </services>
-</response>Known services are:
-ntpkeepalivecardmngfacilitymessagenumberingpackagepcbeventpcbtrackerpkglistposeventuserdatauserideacoinlocallocal2lobbylobby2dlstatusnetlogsidmgrglobbyMost of these will usually just return the URL to the eAmuse server (or your fake one ;D). ntp is a
- notable exception, unless you're planning on reimplementing NTP. keepalive will likely alsop be a
- custom URL with query parameters pre-baked.
mode is one of operation, debug, test, or
- factory.
-
pcbtrackerpcbtracker.alive<call ...>
- <pcbtracker method="alive" model*="" hardid="" softid="" accountid="" agree="" ecflag="" />
-</call>ecflag here is determining if the arcade operator allows the use of paseli on this machine.
agree@ and ecflag@ appear to either be totally non present, or present with a value of
- "1", but then again I may be reading the code wrong, so take that with a pinch of salt.
-
<response>
- <pcbtracker status="" time="" limit="" ecenable="" eclimit="" >
-</response>As you might guess, ecenable@ is therefore the flag to determine if paseli is enabled (i.e. the
- arcade operator and the server both allow its use).
pcbeventpcbevent.put<call ...>
- <pcbevent method="put">
- <time __type="time" />
- <seq __type="u32" />
- <item[]>
- <name __type="str" />
- <value __type="s32" />
- <time __type="time" />
- </item[]>
- </pcbevent>
-</call><response>
- <pcbevent status="status" />
-</response>messagemessage.get<call ...>
- <message method="get" model*="" />
-</call><response>
- <message expire="" status="status">
- <item[] name="" start="" end="" data="" />
- </message>
-</response>facilityfacility.get<call ...>
- <facility method="get" privateip*="" encoding*="" />
-</call><response>
- <facility expire=""\ status="status">
- <calendar*>
- <year __type="s16" />
- <holiday __type="s16" />
- </calendar>
- <location>
- <id __type="str" />
- <country __type="str" />
- <region __type="str" />
- <name __type="str" />
- <type __type="u8" />
- <countryname __type="str" />
- <countryjname __type="str" />
- <regionname __type="str" />
- <regionjname __type="str" />
- <customercode __type="str" />
- <companycode __type="str" />
- <latitude __type="s32" />
- <longitude __type="s32" />
- <accuracy __type="u8" />
- </location>
- <line>
- <id __type="str" />
- <class __type="u8" />
- </line>
- <portfw>
- <globalip __type="ip4" />
- <globalport __type="s16" />
- <privateport __type="s16" />
- </portfw>
- <public>
- <flag __type="u8" />1</ flag>
- <name __type="str" />
- <latitude __type="str">0<latitude>
- <longitude __type="str">0<longitude>
- </public>
- <share>
- <eapass*>
- <valid __type="?" />
- </eapass>
- <eacoin>
- <notchamount __type="s32" />
- <notchcount __type="s32" />
- <supplylimit __type="s32">100000<supplylimit>
- </eacoin>
- <url>
- <eapass __type="str">www.ea-pass.konami.net<eapass>
- <arcadefan __type="str">www.konami.jp/am<arcadefan>
- <konaminetdx __type="str">http://am.573.jp<konaminetdx>
- <konamiid __type="str">http://id.konami.jp<konamiid>
- <eagate __type="str">http://eagate.573.jp<eagate>
- </url>
- </share>
- </facility>
-</response>I'm not totally sure what type share/eapass/valid is meant to be, but it's optional, so I'd
- suggest just not bothering and leaving it out :).
| Country | -Code | -
| Hong Kong | -HK |
-
| Taiwan | -TW |
-
| Korea | -KR |
-
| USA | -US |
-
| Thailand | -TH |
-
| Indonesia | -ID |
-
| Singapore | -SG |
-
| Phillipines | -PH |
-
| Macao | -MO |
-
| Japan | -JP |
-
globalip (and associated ports) shold be the IP:port of the cabinet.
region is used for Japan, and has the value JP-[prefecture] where prefecture ranges
- from 1 through 47.
TODO: Compile the list of regions
- -apsmanagerapsmanager.getstat<call ...>
- <apsmanager method="getstat" model*="" />
-</call><response>
- <apsmanager status="status" />
-</response>sidmgrsidmgr.create<call ...>
- <sidmgr method="create">
- <cardtype __type="str" />
- <cardid __type="str" />
- <cardgid __type="str" />
- <steal __type="u8" />
- </sidmgr>
-</call><response>
- <sidmgr status="status">
- <state __type="u32" />
- <e_count __type="u8" />
- <last __type="time" />
- <locked __type="time" />
- <sid __type="str" />
- <cardid_status __type="u8" />
- <refid __type="str" />
- </sidmgr>
-</response>sidmgr.open<call ...>
- <sidmgr method="open" sid="" >
- <pass __type="str" />
- </sidmgr>
-</call><response>
- <sidmgr status="status">
- <state __type="u32" />
- <refid __type="str" />
- <locked __type="time" />
- </sidmgr>
-</response>sidmgr.touch<call ...>
- <sidmgr method="touch" sid="" />
-</call><response>
- <sidmgr status="status" />
-</response>sidmgr.branch<call ...>
- <sidmgr method="branch" sid="" />
-</call><response>
- <sidmgr status="status" />
-</response>sidmgr.close<call ...>
- <sidmgr method="close" sid="" />
- <cause __type="u32" />
- </sidmgr>
-</call><response>
- <sidmgr status="status" />
-</response>dlstatusdlstatus.done<call ...>
- <dlstatus method="done">
- <url>
- <param __type="str" />
- </url>
- <name __type="str" />
- <size __type="s32" />
- </dlstatus>
-</call><response>
- <dlstatus status="status">
- <progress __type="s32" />
- </dlstatus>
-</response>dlstatus.progress<call ...>
- <dlstatus method="progress" />
- <progress __type="s32" />
- </dlstatus>
-</call><response>
- <dlstatus status="status">
- placeholder
- </dlstatus>
-</response>eacoineacoin.checkin<call ...>
- <eacoin method="checkin">
- <cardtype __type="str" />
- <cardid __type="str" />
- <passwd __type="str" />
- <ectype __type="str" />
- </eacoin>
-</call><response>
- <eacoin status="status">
- <sequence __type="s16" />
- <acstatus __type="u8" />
- <acid __type="str" />
- <acname __type="str" />
- <balance __type="s32" />
- <sessid __type="str" />
- </eacoin>
-</response>eacoin.checkout<call ...>
- <eacoin method="checkout">
- <sessid __type="str" />
- </eacoin>
-</call><response>
- <eacoin status="status" />
-</response>eacoin.consume<call ...>
- <eacoin method="consume" esid="">
- <sessid __type="str" />
- <sequence __type="s16" />
- <payment __type="s32" />
- <service __type="s16" />
- <itemtype __type="str" />
- <detail __type="str" />
- </eacoin>
-</call><response>
- <eacoin status="status">
- <acstatus __type="u8" />
- <autocharge __type="u8" />
- <balance __type="s32" />
- </eacoin>
-</response>eacoin.getbalance<call ...>
- <eacoin method="getbalance">
- <sessid __type="str" />
- </eacoin>
-</call><response>
- <eacoin status="status">
- <acstatus __type="u8" />
- <balance __type="s32" />
- </eacoin>
-</response>eacoin.getecstatus<call ...>
- <eacoin method="getecstatus" />
-</call><response>
- <eacoin status="status">
- <ectype __type="str" />
- <ecstatus __type="u8" />
- </eacoin>
-</response>eacoin.touch<call ...>
- <eacoin method="touch">
- <sessid __type="str" />
- </eacoin>
-</call><response>
- <eacoin status="status" />
-</response>eacoin.opchpass<call ...>
- <eacoin method="opchpass">
- <passwd __type="str" />
- <newpasswd __type="str" />
- </eacoin>
-</call><response>
- <eacoin status="status" />
-</response>eacoin.opcheckin<call ...>
- <eacoin method="opcheckin">
- <passwd __type="str" />
- </eacoin>
-</call><response>
- <eacoin status="status">
- <sessid __type="str" />
- </eacoin>
-</response>eacoin.opcheckout<call ...>
- <eacoin method="opcheckout">
- <sessid __type="str" />
- </eacoin>
-</call><response>
- <eacoin status="status" />
-</response>eacoin.getlog<call ...>
- <eacoin method="getlog">
- <sessid __type="str" />
- <logtype __type="str" />
- <ectype __type="str" />
- <target __type="str" />
- <perpage __type="s16" />
- <page __type="s16" />
- <sesstype __type="str" />
- </eacoin>
-</call><response>
- <eacoin status="status">
- <processing __type="u8" />
- <topic>
- <sumdate __type="str" />
- <sumfrom __type="str" />
- <sumto __type="str" />
-
- <today __type="s32" />
- <average __type="s32" />
- <total __type="s32" />
- </topic>
- <summary>
- <items __type="s32" />
- </summary>
- <history>
- <item[]>
- <date __type="str" />
- <consume __type="s32" />
- <service __type="s32" />
- <cardtype __type="str" />
- <cardno __type="str" />
- <title __type="str" />
- <systemid __type="str" />
- </item[]>
- </history>
- </eacoin>
-</response>traceroutetraceroute.send<call ...>
- <traceroute proto="" method="send">
- <hop[]>
- <valid __type="bool">
- <addr __type="ip4">
- <usec __type="u64">
- </hop[]>
- </traceroute>
-</call>hop repeats for every hop (unsurprisingly)
<response>
- <traceroute status="status">
- placeholder
- </traceroute>
-</response>gamegame.sv4_sample<call ...>
- <game method="sv4_sample">
- placeholder
- </game>
-</call><response>
- <game status="status">
- placeholder
- </game>
-</response>game.sv4_new<call ...>
- <game method="sv4_new">
- placeholder
- </game>
-</call><response>
- <game status="status">
- placeholder
- </game>
-</response>game.sv4_load<call ...>
- <game method="sv4_load">
- placeholder
- </game>
-</call><response>
- <game status="status">
- placeholder
- </game>
-</response>game.sv4_load_m<call ...>
- <game method="sv4_load_m">
- placeholder
- </game>
-</call><response>
- <game status="status">
- placeholder
- </game>
-</response>game.sv4_save<call ...>
- <game method="sv4_save">
- placeholder
- </game>
-</call><response>
- <game status="status">
- placeholder
- </game>
-</response>game.sv4_save_m<call ...>
- <game method="sv4_save_m">
- placeholder
- </game>
-</call><response>
- <game status="status">
- placeholder
- </game>
-</response>game.sv4_common<call ...>
- <game method="sv4_common">
- placeholder
- </game>
-</call><response>
- <game status="status">
- placeholder
- </game>
-</response>game.sv4_shop<call ...>
- <game method="sv4_shop">
- placeholder
- </game>
-</call><response>
- <game status="status">
- placeholder
- </game>
-</response>game.sv4_hiscore<call ...>
- <game method="sv4_hiscore">
- placeholder
- </game>
-</call><response>
- <game status="status">
- placeholder
- </game>
-</response>game.sv4_buy<call ...>
- <game method="sv4_buy">
- placeholder
- </game>
-</call><response>
- <game status="status">
- placeholder
- </game>
-</response>game.sv4_exception<call ...>
- <game method="sv4_exception">
- placeholder
- </game>
-</call><response>
- <game status="status">
- placeholder
- </game>
-</response>game.sv4_entry_s<call ...>
- <game method="sv4_entry_s">
- placeholder
- </game>
-</call><response>
- <game status="status">
- placeholder
- </game>
-</response>game.sv4_entry_e<call ...>
- <game method="sv4_entry_e">
- placeholder
- </game>
-</call><response>
- <game status="status">
- placeholder
- </game>
-</response>game.sv4_frozen<call ...>
- <game method="sv4_frozen">
- placeholder
- </game>
-</call><response>
- <game status="status">
- placeholder
- </game>
-</response>game.sv4_lounce<call ...>
- <game method="sv4_lounce">
- placeholder
- </game>
-</call><response>
- <game status="status">
- placeholder
- </game>
-</response>game.sv4_save_e<call ...>
- <game method="sv4_save_e">
- placeholder
- </game>
-</call><response>
- <game status="status">
- placeholder
- </game>
-</response>game.sv4_save_pb<call ...>
- <game method="sv4_save_pb">
- placeholder
- </game>
-</call><response>
- <game status="status">
- placeholder
- </game>
-</response>game.sv4_save_c<call ...>
- <game method="sv4_save_c">
- placeholder
- </game>
-</call><response>
- <game status="status">
- placeholder
- </game>
-</response>game.sv4_play_s<call ...>
- <game method="sv4_play_s">
- placeholder
- </game>
-</call><response>
- <game status="status">
- placeholder
- </game>
-</response>game.sv4_play_e<call ...>
- <game method="sv4_play_e">
- placeholder
- </game>
-</call><response>
- <game status="status">
- placeholder
- </game>
-</response>game.sv4_serial<call ...>
- <game method="sv4_serial">
- placeholder
- </game>
-</call><response>
- <game status="status">
- placeholder
- </game>
-</response>game.sv4_save_fi<call ...>
- <game method="sv4_save_fi">
- placeholder
- </game>
-</call><response>
- <game status="status">
- placeholder
- </game>
-</response>game.sv4_print<call ...>
- <game method="sv4_print">
- placeholder
- </game>
-</call><response>
- <game status="status">
- placeholder
- </game>
-</response>game.sv4_print_h<call ...>
- <game method="sv4_print_h">
- placeholder
- </game>
-</call><response>
- <game status="status">
- placeholder
- </game>
-</response>game.sv4_load_r<call ...>
- <game method="sv4_load_r">
- placeholder
- </game>
-</call><response>
- <game status="status">
- placeholder
- </game>
-</response>game.sv4_save_campaign<call ...>
- <game method="sv4_save_campaign">
- placeholder
- </game>
-</call><response>
- <game status="status">
- placeholder
- </game>
-</response>I'll try and figure these out in due course, promise!
\ No newline at end of file diff --git a/styles.css b/styles.css index 13908aa..357e06b 100644 --- a/styles.css +++ b/styles.css @@ -45,6 +45,7 @@ p { } code { + vertical-align: middle; letter-spacing: .02em; padding: 2px 4px; font-size: 90%; @@ -53,6 +54,9 @@ code { border-radius: 4px; word-break: break-word; } +td > code { + word-break: normal; +} code > a { color: inherit; }